Use of Information Collected
Gasfireplaceandchimneyservicenearme.online may deem it necessary to follow websites and/or pages that their users may frequent in an effort to gleam what types of services and/or products may be the most popular to customers or the general public.
Those third parties shall be strictly prohibited from making use of your personal information, other than to deliver those services which you requested, and as such they are thus required in accordance with this agreement to maintain the confidentiality of all your information.. Gasfireplaceandchimneyservicenearme.online may find it beneficial to share specific data with their trusted partners in an effort to conduct statistical analysis, provide you with email and/or postal mail, deliver support and/or arrange for deliveries to be made
Gasfireplaceandchimneyservicenearme.online, from time to time, may feel it necessary to make contact with you on behalf of other external business partners with regards to a specific offer which may be of interest to you. If you consent or show interest in presented offers, then, at that time, specific identifiable information, such as name, email address and/or telephone number, may be shared with the third party.
Gasfireplaceandchimneyservicenearme.online does not now, nor will it in the future, sell, rent or lease any of its customer lists and/or names to any third parties.
At times, we may find it necessary to use personally identifiable information meant to inform you of other possible products and/or services that may be available to you from Gasfireplaceandchimneyservicenearme.online and its subsidiaries and may also be in contact with you with regards to completing surveys and/or research questionnaires related to your opinion of current or possible new services that are offered or may be offered.. Gasfireplaceandchimneyservicenearme.online may collect and may make use of personal information to assist in the operation of our website and to ensure delivery of the services you need and request
Gasfireplaceandchimneyservicenearme.online may disclose your personal information, without prior notice to you, only if required to do so pursuant to applicable laws and/or in a good faith belief that such action is deemed necessary or required to:
Email: privacy@gasfireplaceandchimneyservicenearme.online
Unsubscribe or Opt-Out
To discontinue or unsubscribe to our website please send an email that you wish to the email on our website. All users and/or visitors to our website have the option to discontinue receiving communication from us and/or reserve the right to discontinue receiving communications by way of email or newsletters. If you wish to unsubscribe or opt-out from any third party websites, you must go to that specific website to unsubscribe and/or opt-out.
- Conform to decrees, laws and/or statutes or in an effort to comply with any process which may be served upon Gasfireplaceandchimneyservicenearme.online and/or its website;
- Safeguard and/or preserve all the rights and/or property of Gasfireplaceandchimneyservicenearme.online; and
- Perform under demanding conditions in an effort to safeguard the personal safety of users and/or the general public.
Acceptance of Terms
If you are not in agreement with our terms and conditions, then you should refrain from further use of our sites. In addition, your continued use of our website following the posting of any updates or changes to our terms and conditions shall mean that you are in agreement and acceptance of such changes.. Through the use of this website, you are hereby accepting the terms and conditions stipulated within the aforementioned Privacy Policy Agreement
Children Under Age of 13
Anyone under the age of thirteen (13) must seek and obtain parent or guardian permission to use this website.. If it is determined that such information has been inadvertently collected on anyone under the age of thirteen (13), we shall immediately take the necessary steps to ensure that such information is deleted from our system’s database. Gasfireplaceandchimneyservicenearme.online does not knowingly collect personal identifiable information from children under the age of thirteen (13) without verifiable parental consent
Security
Gasfireplaceandchimneyservicenearme.online shall endeavor and shall take every precaution to maintain adequate physical, procedural and technical security with respect to its offices and information storage facilities so as to prevent any loss, misuse, unauthorized access, disclosure or modification of the user’s personal information under our control.
Google AdSense (Google Ireland Limited)
Personal Data processed: Trackers; Usage Data.
. In order to understand Google's use of data, consult Google's partner policy
This service uses the “DoubleClick” Cookie, which tracks use of this Application and User behavior concerning ads, products and services offered. . Users may decide to disable all the DoubleClick Cookies by going to: Google Ad Settings. Google AdSense is an advertising service provided by Google Ireland Limited
This processing constitutes: a sale according to the CCPA, VCDPA, CPA, CTDPA and UCPA, a sharing according to the CCPA, targeted advertising according to the VCDPA, CPA, CTDPA and UCPA
. Place of processing: Ireland – Privacy Policy – Opt Out
The services contained in this section enable the Owner to monitor and analyze web traffic and can be used to keep track of User behavior.
. Category of personal information collected according to the CCPA: internet information
Collection of Information
Such collected information may include, but may not be limited to, your IP address, browser type, domain name, access time and various website addresses. The gathering of this information may be used for maintaining the quality of service we provide, as well as providing overall general statistics related to the use of our website and others.. It is even possible that we may gather information about your computer hardware and/or software
It is the intent of this site to use personal information only for the purpose for which it was requested and any additional uses specifically provided on this site.. Please rest assured that this site shall only collect personal information that you knowingly and willingly provide by way of surveys, completed membership forms, and emails
Information automatically collected when visiting our website, which may include cookies, third party tracking technologies and server logs
Gasfireplaceandchimneyservicenearme.online may also have the occasion to collect anonymous demographic information that may not be unique to you and may even gather additional or other personal and/or non-personal information, such as age, gender, household income, political affiliation, race and religion, at a later time.
Voluntarily provided information which may include your name, address, email address, billing and/or credit card information etc, which may be used when you purchase products and/or services and to deliver the services you have requested;
This website collects various types of information, such as:
Google Analytics (Google Inc.)
This processing constitutes: a sale according to the CCPA, VCDPA, CPA, CTDPA and UCPA
Place of processing: US – Privacy Policy – Opt Out.
. Category of personal information collected according to the CCPA: internet information
. Google Analytics is a web analysis service provided by Google Inc. Google may use the Data collected to contextualize and personalize the ads of its own advertising network. Google utilizes the Data collected to track and examine the use of this Application, to prepare reports on its activities and share them with other Google services. (“Google”)
Personal Data processed: Cookies; Usage Data.
Amazon Associates Disclosure
Gasfireplaceandchimneyservicenearme.online is a participant in the Amazon Services LLC Associates Program, an affiliate advertising program designed to provide a means for sites to earn advertising fees by advertising and linking to amazon.com
Changes to Privacy Policy Agreement
Users at that time shall have the option as to whether or not to permit the use of their information in this separate manner.. If at any point in time Gasfireplaceandchimneyservicenearme.online decides to make use of any personally identifiable information on file, in a manner vastly different from that which was stated when this information was initially collected, the user or users shall be promptly notified by email. Gasfireplaceandchimneyservicenearme.online reserves the right to update and/or change the terms of our privacy policy, and as such we will post those change to our website homepage at golubkakitchen.com, so that our users and/or visitors are always aware of the type of information we collect, how it will be used, and under what circumstances, if any, we may disclose such information
ONLINE PRIVACY POLICY AGREEMENT
Our privacy policy has been designed and created to ensure those affiliated with Gasfireplaceandchimneyservicenearme.online of our commitment and realization of our obligation not only to meet but to exceed most existing privacy standards.. Gasfireplaceandchimneyservicenearme.online is committed to keeping any and all personal information collected of those individuals that visit our website and make use of our on-line facilities and services accurate, confidential, secure and private
Through the use of Gasfireplaceandchimneyservicenearme.online you are herein consenting to the following data procedures expressed within this agreement.. This Privacy Policy Agreement shall apply to Gasfireplaceandchimneyservicenearme.online and thus it shall govern any and all data collection and usage thereof
Links to Other Web Sites
Gasfireplaceandchimneyservicenearme.online does not claim nor accept responsibility for any privacy policies, practices and/or procedures of other such websites. Our website does contain links to affiliate and other websites. Therefore, we encourage all users and visitors to be aware when they leave our website and to read the privacy statements of each and every website that collects personally identifiable information. The aforementioned Privacy Policy Agreement applies only and solely to the information collected by our website.
How to Contact Us
If you have any questions or concerns regarding the Privacy Policy Agreement related to our website, please feel free to contact us at the following email, telephone number or mailing address.


